PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA030219-PA
Common NameOsI_30404
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 185aa    MW: 20159.1 Da    PI: 4.8394
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA030219-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.41.6e-12849344
                      --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
            SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                       e++  r+v fskRr+ ++K A+ELSv  +a+va ++fs+ g
  BGIOSGA030219-PA  8 MESEEARKVCFSKRRADLFKMASELSVHFNADVAAVVFSPAG 49
                      689999**********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-5358IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-14669IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.848649IPR002100Transcription factor, MADS-box
PfamPF003191.6E-17750IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MVASRRKMES EEARKVCFSK RRADLFKMAS ELSVHFNADV AAVVFSPAGN RAYSIGDPSV  60
MDRFLSSLPA PAPPAETEPE PEVDWSVMEE LSRQCGQLQA MVDAHKARLE KAEEKLRESG  120
AAAWMMDLEA EVGRMAPEDV LALVTKLAVL RDGVAERAHE MLREALLAVA APTPTIPTTP  180
PPAGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611505.11e-129PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLB8BCY51e-131B8BCY5_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA030219-PA1e-130(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2026177
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.17e-14AGAMOUS-like 29